Home / Products / proteins / BIGH3, Fasciclin domain 4 (502-636aa) Human, Recombinant, E.coli

BIGH3, Fasciclin domain 4 (502-636aa) Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
BIGH3, also known as TGFBI and ig-h3, is an extracellular matrix protein induced by transforming growth factor (TGF)-beta 1. BIGH3 protein is involved in cell growth, cell differentiation, wound healing and cell adhesion. In addition, some missense mutations of BIGH3 were identified in families affected with human autosomal dominant corneal dystrophies.
List Price: $355
  • Buy 5 for $337.25 each and save 5%
  • Buy 21 for $319.5 each and save 10%
  • Buy 31 for $301.75 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01336
Size 100 µg
Host E.coli
Accession
Molecular Weight 14.5 kDa (135 aa),confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MGTVMDVLKGDNRFSMLVAAIQSAGLTETLNREGVYTVFAPTNEAFRALPPRERSRLLGDAKELANILKYHIGDEILVSGGIGALVRLKSLQGDKLEVSLKNNVVSVNKEPVAEPDIMATNGVVHVITNVLQPPA
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0)
Other Names Transforming growth factor (TGF) beta-induced protein, TGFBI, Big-h3, Beta ig-h3.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap