Home / Products / proteins / BID, 1-195aa, Human, Recombinant, E.coli

BID, 1-195aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
BID is a pro-apoptotic Bcl-2 protein containing only the BH3 domain. In response to apoptotic signaling, BID interacts with another Bcl-2 family protein, Bax, leading to the insertion of Bax into the outer mitochondrial membrane.
List Price: $709
  • Buy 5 for $673.55 each and save 5%
  • Buy 21 for $638.1 each and save 10%
  • Buy 31 for $602.65 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01334
Size 100 µg
Host E.coli
Accession
Molecular Weight 21.9 kDa (195 aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MDCEVNNGSSLRDECITNLLVFGFLQSCSDNSFRRELDALGHELPVLAPQWEGYDELQTDGNRSSHSRLGRIEADSESQEDIIRNIARHLAQVGDSMDRSIPPGLVNGLALQLRNTSRSEEDRNRDLATALEQLLQAYPRDMEKEKTMLVLALLLAKKVASHTPSLLRDVFHTTVNFINQNLRTYVRSLARNGMD
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH 8.0) containing 20% glycerol
Other Names BH3 interacting domain death agonist isoform 2, FP497.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap