BDNF, 129-247 aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
BDNF also known as Brain-derived neurotrophic factor. This protein is during development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. The versatility of BDNF is emphasized by its contribution to a range of adaptive neuronal responses including long-term potentiation (LTP), long-term depression (LTD), certain forms of short-term synaptic plasticity, as well as homeostatic regulation of intrinsic neuronal excitability. Recombinant human BDNF protein, was expressed in E.coli.
List Price: $654
  • Buy 5 for $621.3 each and save 5%
  • Buy 21 for $588.6 each and save 10%
  • Buy 31 for $555.9 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01319
Size 100 µg
Host E.coli
Accession
Molecular Weight 15.8 kDa (140aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMHSDPARRGELSVCDSISEWVTAADKKTAVDMSGGTVTVLEKVPVSKGQLKQYFYETKCNPMGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDSKKRIGWRFIRIDTSCVCTLTIKRGR
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 10% glycerol
Other Names Brain-derived neurotrophic factor isoform a, ANON2, BuLN2
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap