BCL2L2, 1-172aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
BCL2-like protein 2, also known as BCL2L2, is a member of the Bcl-2 family of proteins that regulates outer mitochondrial membrane permeability. BCL2L2 is an anti apoptotic member that prevents release of cytochrome c from the mitochondria intermembrane space into the cytosol.
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01314
Size 100 µg
Molecular Weight 20.9 kDa (192aa)
Sequences MGSSHHHHHHSSGLVPRGSHMATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRT
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH7.5) containing 100mM NaCl, 10% glycerol
Other Names BCL2-like protein 2, Apoptosis regulator Bcl-W, BCLW.
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2018 TZYBIOTECH. All Rights Reserved. SiteMap