Home / Products / proteins / BCL2L11, 1-138 aa Human, His tag, E.coli

BCL2L11, 1-138 aa Human, His tag, E.coli

Categories: [Proteins / Peptides]
BCL2L11 (Bcl-2-like protein 11) belongs to the Bcl-2 family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The expression of BCL2L11 can be induced by nerve growth factor (NGF), as well as by the forkhead transcription factor FKHR-L1, which suggests a role of this gene in neuronal and lymphocyte apoptosis.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01313
Size 50 µg
Host E.coli
Accession
Molecular Weight 18.5kDa (162aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMAKQPSDVSSECDREGRQLQPAERPPQLRPGAPTSLQTEPQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQAEPADMRPEIWIAQELRRIGDEFNAYYARRVFLNNYQAAEDHPRMVILRLLRYIVRLVWRMH
Purity > 95% by HPLC
Concentration 0.5mg/ml
Formulation Liquid. In 20 mM Tris-HCl buffer, pH8.0, 2M Urea, 20% glycerol 5mM DTT, 300mM NaCl
Other Names BCL2-like 11, BAM, BIM, BIM-alpha6, BIM-beta6, BIM-beta7, BimEL, BimL, BOD.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap