Home / Products / proteins / BCL2A1, 1-152aa, Human, His tag, E.coli

BCL2A1, 1-152aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
BCL2A1, also known as Bcl-2-related protein A1, retards apoptosis induced by IL-3 deprivation. This protein functions in the response of hemopoietic cells to external signals and in maintaining endothelial survival during infection. Recombinant human BCL2A1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01311
Size 20 µg
Host E.coli
Accession
Molecular Weight 20.2 kDa (176aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMTDCEFGYIYRLAQDYLQYVLQIPQPGSGPSKTSRVLQKVAFSVQKEVEKNLKSCLDNVNVVSVDTARTLFNQVMEKEFEDDIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISYFVAEFIMNNTGEWIRQNGGWENGFVKKFEPKS
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 10% glycerol
Other Names Bcl-2-related protein A1, BCL2L5, BFL1, GRS, HBPA1.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap