Bcl-2, 1-211 aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
Bcl-2, also known as B-cell lymphoma protein 2 alpha, is an anti-apoptotic protein located primarily in the outer mitochondrial membrane that blocks the apoptotic death of some cells such as lymphocytes. BCL-2 is thought to regulate cell death by controlling the mitochondrial membrane permeability during apotosis.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01308
Size 100 µg
Molecular Weight 25.4 kDa (231 aa)
Sequences MGSSHHHHHHSSGLVPRGSHMAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDVGAAPPGAAPAPGIFSSQPGHTPHPAASRDPVARTSPLQTPAAPGAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMSPLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFD
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 20% glycerol 2 mM DTT
Other Names B-cell lymphoma protein 2 alpha.
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2018 TZYBIOTECH. All Rights Reserved. SiteMap