BATF3, 1-127aa Human, His tag, E.coli

Categories: [Proteins / Peptides]
Basic leucine zipper transcriptional factor ATF-like 3, also known as BATF3, is a 127 amino acid protein that localizes to the nucleus and contains one bZIP domain. Interacting with c-Jun, BATF3 functions as a negative regulator of AP-1-mediated transcription, specifically by heterodimerizing with c-Jun and binding to DNA response elements. Recombinant human BATF3 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01298
Size 20 µg
Host E.coli
Accession
Molecular Weight 16.9 kDa (150aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMSQGLPAAGSVLQRSVAAPGNQPQPQPQQQSPEDDDRKVRRREKNRVAAQRSRKKQTQKADKLHEEYESLEQENTMLRREIGKLTEELKHLTEALKEHEKMCPLLLCPMNFVPVPPRPDPVAGCLPR
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by BCA assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.2M NaCl, 30% glycerol
Other Names Basic leucine zipper transcriptional factor ATF-like 3, JDP1, JUNDM1, SNFT
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap