Home / Products / proteins / BATF, 1-125aa, Human, His tag, E.coli

BATF, 1-125aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
BATF, also known as SFA2, is a nuclear basic leucine zipper protein that belongs to the AP-1/ATF superfamily of transcription factors. BATF is strongly expressed in mature T and B lymphocytes, and is upregulated after transformation by human T-cell leukemia virus type I.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01297
Size 100 µg
Host E.coli
Accession
Molecular Weight 16.2 kDa (145aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMPHSSDSSDSSFSRSPPPGKQDSSDDVRRVQRREKNRIAAQKSRQRQTQKADTLHLESEDLEKQNAALRKEIKQLTEELKYFTSVLNSHEPLCSVLAASTPSPPEVVYSAHAFHQPHVSSPRFQP
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by BCA assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 0.2M NaCl, 2mM DTT, 40% glycerol
Other Names Basic leucine zipper transcriptional factor ATF-like, B-ATF, BATF1, SFA-2, SFA2.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap