Home / Products / proteins / B3GNT2, 29-397aa, Human, His-tagged, Baculovirus

B3GNT2, 29-397aa, Human, His-tagged, Baculovirus

Categories: [Proteins / Peptides]
B3GNT2, also known as N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2, belongs to the beta-1,3-N-acetylglucosaminyltransferase family. It is a type II transmembrane protein which prefers the substrate of lacto-N-neotetraose. It catalyzes the initiation and elongation of poly-N- acetyllactosamine chains. Recombinant human B3GNT2, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques
List Price: $302
  • Buy 5 for $286.9 each and save 5%
  • Buy 21 for $271.8 each and save 10%
  • Buy 31 for $256.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01285
Size 20 µg
Host Baculovirus
Accession
Molecular Weight 43.5kDa (375aa), 40-57kDa (SDS-PAGE under reducing conditions)
AP_Mol_Weight
Tag
Sequences ADPKSSSQEKNGKGEVIIPKEKFWKISTPPEAYWNREQEKLNRQYNPILSMLTNQTGEAGRLSNISHLNYCEPDLRVTSVVTGFNNLPDRFKDFLLYLRCRNYSLLIDQPDKCAKKPFLLLAIKSLTPHFARRQAIRESWGQESNAGNQTVVRVFLLGQTPPEDNHPDLSDMLKFESEKHQDILMWNYRDTFFNLSLKEVLFLRWVSTSCPDTEFVFKGDDDVFVNTHHILNYLNSLSKTKAKDLFIGDVIHNAGPHRDKKLKYYIPEVVYSGLYPPYAGGGGFLYSGHLALRLYHITDQVHLYPIDDVYTGMCLQKLGLVPEKHKGFRTFDIEEKNKNNICSYVDLMLVHSRKPQEMIDIWSQLQSAHLKCHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol
Other Names N-acetyllactosaminide beta-1,3-N-acetylglucosaminyltransferase 2 , B3GNT2, B3GN-T2, B3GNT, B3GNT-2, B3GNT1, BETA3GNT, BGnT-2, BGNT2, 3-galactosyltransferase 7.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap