ATP1B2, 68-290aa, Human, His-tag, Baculovirus

Categories: [Proteins / Peptides]
ATP1B2, as known as sodium/potassium-transporting ATPase subunit beta-2 isoform 1, is the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ ATPases. It is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na+ and K+ ions across the plasma membrane. The precise function of the beta-2 subunit is not known. This protein is composed of 3 subunits: alpha (catalytic), beta and gamma. Recombinant human ATP1B2, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $302
  • Buy 5 for $286.9 each and save 5%
  • Buy 21 for $271.8 each and save 10%
  • Buy 31 for $256.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01271
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 26.4kDa (232aa)28-40kDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag
Sequences ADPDHTPKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVINFYAGANQSMNVTCAGKRDEDAENLGNFVMFPANGNIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKTHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Sodium/potassium-transporting ATPase subunit beta-2 isoform 1, ATP1B2, AMOG
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap