Home / Products / proteins / ATOX1, 1-68aa, Human, His tag, E.coli

ATOX1, 1-68aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
Copper transport protein ATOX1, also known as HAH1, a metal transport protein that belongs to the ATX1 family. ATOX1 is involved in cellular antioxidant defense and can bind and deliver cytosolic copper to the copper ATPase proteins.
List Price: $316
  • Buy 5 for $300.2 each and save 5%
  • Buy 21 for $284.4 each and save 10%
  • Buy 31 for $268.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01267
Size 100 µg
Host E.coli
Accession
Molecular Weight 9.5 kDa (88aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH8.0) containing 1mM DTT, 10% glycerol
Other Names Copper transport protein ATOX1, Antioxidant protein 1, ATX1, HAH1.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap