ASRGL1, 1-308aa Human, His tag, E.coli

Categories: [Proteins / Peptides]
Isoaspartyl peptidase/L-asparaginase, also known as ASRGL1, is a 308 amino acid protein belonging to the Ntn-hydrolase family. ASRGL1 has been identified as an autoantigenic protein that is present in the mid-piece of sperm after obstruction of the male reproductive tract. It is expressed highly in testis, but is also expressed in brain, kidney and gastrointestinal tissues. High levels of ASRGL1 have also been identified in ovarian, uterine and mammary tumors in comparison with normal tissues of the same origin. Recombinant human ASRGL1 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01256
Size 50 µg
Host E.coli
Accession
Molecular Weight 34.4 kDa (331aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMNPIVVVHGGGAGPISKDRKERVHQGMVRAATVGYGILREGGSAVDAVEGAVVALEDDPEFNAGCGSVLNTNGEVEMDASIMDGKDLSAGAVSAVQCIANPIKLARLVMEKTPHCFLTDQGAAQFAAAMGVPEIPGEKLVTERNKKRLEKEKHEKGAQKTDCQKNLGTVGAVALDCKGNVAYATSTGGIVNKMVGRVGDSPCLGAGGYADNDIGAVSTTGHGESILKVNLARLTLFHIEQGKTVEEAADLSLGYMKSRVKGLGGLIVVSKTGDWVAKWTSTSMPWAAAKDGKLHFGIDPDDTTITDLP
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In Phosphate buffer saline (pH 7.4) containing 10% glycerol , 1mM DTT
Other Names Isoaspartyl peptidase/L-asparaginase, ALP, ALP1, CRASH
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap