Home / Products / proteins / ASPRV1, 191-326 aa, Human, His tag, E.coli

ASPRV1, 191-326 aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
ASPRV1, also known as MUNO, SASP and ASAPase, is a protein that contains 1 peptidase A2 domain. This protein is expressed primarily in the granular layer of the epidermis and inner root sheath of hair follicles and localized to membrane region.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01254
Size 100 µg
Host E.coli
Accession
Molecular Weight 17.2 kDa (159aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSSMGKGYYLKGKIGKVPVRFLVDSGAQVSVVHPNLWEEVTDGDLDTLQPFENVVKVANGAEMKILGVWDTAVSLGKLKLKAQFLVANASAEEAIIGTDVLQDHNAILDFEHRTCTLKGKKFRLLPVGGSLEDEFDLE
Purity > 95% by HPLC
Concentration 0.25 mg/ml
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 10% glycerol,1mM DTT
Other Names Aspartic peptidase, retroviral-like 1, MUNO, SASP, SASPase, Taps.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap