ARSM2, 1-107aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
ARMS2 is a protein that is thought to play a role in diseases in the elderly. Mutations in ARSM2 have been associated with age-related macular degeneration. Recombinant human ARMS2 protein, fused to His-tag at N-terminus, was expressed in E.coli .
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01239
Size 20 µg
Molecular Weight 13.8kDa (130aa)
Sequences MGSSHHHHHHSSGLVPRGSHMGSMLRLYPGPMVTEAEGKGGPEMASLSSSVVPVSFISTLRESVLDPGVGGEGASDKQRSKLSLSHSMIPAAKIHTELCLPAFFSPAGTQRRFQQPQHHLTLSIIHTAAR
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing , 10% glycerol, 0.4M Urea
Other Names Age-related maculopathy susceptibility protein 2, Age-related maculopathy susceptibility 2, ARMD8
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2018 TZYBIOTECH. All Rights Reserved. SiteMap