Home / Products / proteins / ARSM2, 1-107aa, Human, His tag, E.coli

ARSM2, 1-107aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
ARMS2 is a protein that is thought to play a role in diseases in the elderly. Mutations in ARSM2 have been associated with age-related macular degeneration. Recombinant human ARMS2 protein, fused to His-tag at N-terminus, was expressed in E.coli .
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01239
Size 20 µg
Host E.coli
Accession
Molecular Weight 13.8kDa (130aa)
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMLRLYPGPMVTEAEGKGGPEMASLSSSVVPVSFISTLRESVLDPGVGGEGASDKQRSKLSLSHSMIPAAKIHTELCLPAFFSPAGTQRRFQQPQHHLTLSIIHTAAR
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing , 10% glycerol, 0.4M Urea
Other Names Age-related maculopathy susceptibility protein 2, Age-related maculopathy susceptibility 2, ARMD8
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap