Apolipoprotein A-1, 25-267 aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
Apolipoprotein A-1, also known as APOA1, is a human protein with a specific role in lipid metabolism. It is the major protein component of high density lipoprotein (HDL) in plasma. This protein promotes cholesterol efflux from tissues to the liver for excretion.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01199
Size 100 µg
Host E.coli
Accession
Molecular Weight 30.3 kDa (264aa)
AP_Mol_Weight
Tag
Sequences MGSSHHHHHHSSGLVPRGSHMDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing, 10% glycerol
Other Names APOA1.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap