APOH, 20-345aa, Human, His-tag, Baculovirus

Categories: [Proteins / Peptides]
APOH, also known as Beta-2-glycoprotein 1, is a glycosylated member of the complement control superfamily of proteins. APOH binds to various kinds of negatively charged substances such as heparin, phospholipids, and dextran sulfate. This protein may prevent activation of the intrinsic blood coagulation cascade by binding to phospholipids on the surface of damaged cells. It has a complex involvement in agglutination, it appears to alter Adenosine diphosphate (ADP) mediated agglutination of platelets. Recombinant human APOH protein, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $302
  • Buy 5 for $286.9 each and save 5%
  • Buy 21 for $271.8 each and save 10%
  • Buy 31 for $256.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01197
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 37.3kDa (335aa), 40-57KDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag
Sequences ADPGRTCPKPDDLPFSTVVPLKTFYEPGEEITYSCKPGYVSRGGMRKFICPLTGLWPINTLKCTPRVCPFAGILENGAVRYTTFEYPNTISFSCNTGFYLNGADSAKCTEEGKWSPELPVCAPIICPPPSIPTFATLRVYKPSAGNNSLYRDTAVFECLPQHAMFGNDTITCTTHGNWTKLPECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPCHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Beta-2-glycoprotein 1, APOH, BG, B2G1, B2GP1, Apolipoprotein H
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap