Apoa1, 25-264aa , Mouse, His tag, E.coli

Categories: [Proteins / Peptides]
Apoa1 also known as Apolipoprotein A-I, is the major protein component of high density lipoprotein (HDL) in plasma. This protein promotes cholesterol efflux from tissues to the liver for excretion. And it is a cofactor for lecithin cholesterolacyltransferase (LCAT) which is responsible for the formation of most plasma cholesteryl esters. Defects in the Apoa1 are associated with HDL deficiency including Tangier disease. Recombinant mouse Apoa1, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01192
Size 100 µg
Molecular Weight 30.3kDa (263aa) confirmed by MALDI-TOF
Sequences MGSSHHHHHHSSGLVPRGSHMGSDEPQSQWDKVKDFANVYVDAVKDSGRDYVSQFESSSLGQQLNLNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEKETDWVRQEMNKDLEEVKQKVQPYLDEFQKKWKEDVELYRQKVAPLGAELQESARQKLQELQGRLSPVAEEFRDRMRTHVDSLRTQLAPHSEQMRESLAQRLAELKSNPTLNEYHTRAKTHLKTLGEKARPALEDLRHSLMPMLETLKTQVQSVIDKASETLTAQ
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Bradford assay)
Formulation Liquid, In Phosphate buffered saline (pH7.4) containing 20% glycerol, 1mM DTT
Other Names Apolipoprotein A-I , Alp-1, apo-AI, Apoa-1, apoA-I, Brp-14,Ltw-1, Lvtw-1, Sep-1, Sep-2, Sep2, Apolipoprotein AI
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2018 TZYBIOTECH. All Rights Reserved. SiteMap