Home / Products / proteins / APEX1, 1-318aa, Human, T7 tag, E.coli

APEX1, 1-318aa, Human, T7 tag, E.coli

Categories: [Proteins / Peptides]
APEX1, also known as REF1 or APE1 (Apurinic / apyrimidinic endonuclease), is responsible for the incision of DNA basic sites during base excision repair. It has also been shown to stimulate the DNA binding activity of numerous transcription factors that are involved in cancer promotion and progression.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01189
Size 50 µg
Host E.coli
Accession
Molecular Weight 36.9 kDa (332aa) confirmed by MALDI-TOF
AP_Mol_Weight
Tag
Sequences MASMTGGQQMGRGSMPKRGKKGAVAEDGDELRTEPEAKKSKTAAKKNDKEAAGEGPALYEDPPDQKTSPSGKPATLKICSWNVDGLRAWIKKKGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGYSGVGLLSRQCPLKVSYGIGEEEHDQEGRVIVAEFDSFVLVTAYVPNAGRGLVRLEYRQRWDEAFRKFLKGLASRKPLVLCGDLNVAHEEIDLRNPKGNKKNAGFTPQERQGFGELLQAVPLADSFRHLYPNTPYAYTFWTYMMNARSKNVGWRLDYFLLSHSLLPALCDSKIRSKALGSDHCPITLYLAL
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 0.2M NaCl, 2mM DTT, 10% glycerol
Other Names APEX nuclease (multifunctional DNA repair enzyme) 1, APE, APE1, APEN, APX, HAP1, REF-1, REF1.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap