Home / Products / proteins / ANKRD54, 1-300aa, Human, His tag, E.coli

ANKRD54, 1-300aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
ANKRD54, also known as LIAR, contains 4 ANK repeats. This protein plays an important role in regulating intracellular signaling events associated with erythroid terminal differentiation. This protein interacts (via ankyrin repeat region) with LYN (via SH3-domain) in an activation-independent status of LYN. It forms a multiprotein complex with LYN and HCLS1. ANKRD54 also interacts with TSN2, VAV1, DBNL AND LASP1. Recombinant human ANKRD54 protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01164
Size 20 µg
Host E.coli
Accession
Molecular Weight 34.9kDa (323aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMAAAAGDADDEPRSGHSSSEGECAVAPEPLTDAEGLFSFADFGSALGGGGAGLSGRASGGAQSPLRYLHVLWQQDAEPRDELRCKIPAGRLRRAARPHRRLGPTGKEVHALKRLRDSANANDVETVQQLLEDGADPCAADDKGRTALHFASCNGNDQIVQLLLDHGADPNQRDGLGNTPLHLAACTNHVPVITTLLRGGARVDALDRAGRTPLHLAKSKLNILQEGHAQCLEAVRLEVKQIIHMLREYLERLGQHEQRERLDDLCTRLQMTSTKEQVDEVTDLLASFTSLSLQMQSMEKR
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 0.15M NaCl, 20% glycerol, 1mM DTT
Other Names Ankyrin repeat domain-containing protein 54, LIAR, Ankyrin repeat domain containing protein 54
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap