ANGPTL3, 17-460aa, Human, His-tag, Baculovirus

Categories: [Proteins / Peptides]
ANGPTL3, as known as angiopoietin-related protein 3, is a secreted glycoprotein that is structurally related to the angiopoietins. This protein directly inhibits lipoprotein lipase (LPL) and endothelial lipase (EL), enzymes responsible for hydrolyzing circulating triglycerides and HDL phospholipids. This activity requires a putative heparin-binding motif which is N-terminal to the coiled coil domain. Recombinant human ANGPTL3, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $402
  • Buy 5 for $381.9 each and save 5%
  • Buy 21 for $361.8 each and save 10%
  • Buy 31 for $341.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01160
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 52.9kDa (453aa), 25-70kDa (SDS-PAGE under reducing conditions))
AP_Mol_Weight
Tag
Sequences ADPSRIDQDNSSFDSLSPEPKSRFAMLDDVKILANGLLQLGHGLKDFVHKTKGQINDIFQKLNIFDQSFYDLSLQTSEIKEEEKELRRTTYKLQVKNEEVKNMSLELNSKLESLLEEKILLQQKVKYLEEQLTNLIQNQPETPEHPEVTSLKTFVEKQDNSIKDLLQTVEDQYKQLNQQHSQIKEIENQLRRTSIQEPTEISLSSKPRAPRTTPFLQLNEIRNVKHDGIPAECTTIYNRGEHTSGMYAIRPSNSQVFHVYCDVISGSPWTLIQHRIDGSQNFNETWENYKYGFGRLDGEFWLGLEKIYSIVKQSNYVLRIELEDWKDNKHYIEYSFYLGNHETNYTLHLVAITGNVPNAIPENKDLVFSTWDHKAKGHFNCPEGYSGGWWWHDECGENNLNGKYNKPRAKSKPERRRGLSWKSQNGRLYSIKSTKMLIHPTDSESFEHHHHHH
Purity > 95% by HPLC
Concentration 0.25mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Angiopoietin-related protein 3 , ANGPTL3, ANG-5, ANGPT5, ANL3, FHBL2, ANG 5ANG-5, ANG5, Angiopoietin 5, Angiopoietin like 3Angiopoietin related protein 3, Angiopoietin-5.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap