AMELX, 17-191aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
AMELX is a member of the amelogenin family of extracellular matrix proteins. Amelogenins are involved in biomineralization during tooth enamel development. Mutations in AMELX cause X-linked amelogenesis imperfecta. Alternative splicing results in multiple transcript variants encoding different isoforms. Recombinant human AMELX protein, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01145
Size 20 µg
Molecular Weight 22 kDa (198aa), confirmed by MALDI-TOF
Sequences MGSSHHHHHHSSGLVPRGSHMGSMPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD
Purity > 95% by HPLC
Concentration 0.25 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.5) containing 0.2M NaCl, 30% glycerol, 1mM DTT
Other Names Amelogenin, X isoform isoform 1, Amelogenin, X-linked, AI1E, AIH1, ALGN, AMG, AMGL, AMGX
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2018 TZYBIOTECH. All Rights Reserved. SiteMap