Aldose reductase, 1-316aa, Human, Recombinant, E.coli

Categories: [Proteins / Peptides]
Aldose reductase (AKR1B1) is a member of the aldo-keto reductase (AKR) superfamily and catalyzes the NADPH-dependent reduction of a wide variety of carbonyl-containing compounds to their corresponding alcohols. This protein is implicated in the development of diabetic complications by catalyzing the reduction of glucose to sorbitol.
List Price: $256
  • Buy 5 for $243.2 each and save 5%
  • Buy 21 for $230.4 each and save 10%
  • Buy 31 for $217.6 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01136
Size 100 µg
Molecular Weight 35.8kDa (316aa) , confirmed by MALDI-TOF
Sequences MASRLLLNNGAKMPILGLGTWKSPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKLWCTYHEKGLVKGACQKTLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIGISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGSPDRPWAKPEDPSLLEDPRIKAIAAKHNKTTAQVLIRFPMQRNLVVIPKSVTPERIAENFKVFDFELSSQDMTTLLSYNRNWRVCALLSCTSHKDYPFHEEF
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM Tris-HCl buffer (pH8.0) containing 1mM DTT, 10% glycerol
Other Names Aldo-keto reductase family1, member B1; AKR1B1; ADR; ALDR1; ALR2; AR.
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2018 TZYBIOTECH. All Rights Reserved. SiteMap