AKR1D1, 1-326aa, Human, E.coli

Categories: [Proteins / Peptides]
AKR1D1 also known as 3-oxo-5beta-steroid 4-deghydrogenase isoform 1, is a member of the AKR superfamily. The AKR family of proteins are soluble NADPH oxidoreductases. They play important roles in the metabolism of drugs, carcinogens and reactive aldehydes. AKR1D1 is responsible for the catalysis of the 5-betareduction of bile acid intermediates and steroid hormones which carry a delta (4)-3-one structure. AKR1D1 is highly expressed in liver, colon and testis. Deficiency of this enzyme may contribute to hepatic dysfunction. Recombinant AKR1D1 protein was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $310
  • Buy 5 for $294.5 each and save 5%
  • Buy 21 for $279 each and save 10%
  • Buy 31 for $263.5 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01110
Size 50 µg
Host E.coli
Accession
Molecular Weight 37.3 kDa (326aa)
AP_Mol_Weight
Tag
Sequences MDLSAASHRIPLSDGNSIPIIGLGTYSEPKSTPKGACATSVKVAIDTGYRHIDGAYIYQNEHEVGEAIREKIAEGKVRREDIFYCGKLWATNHVPEMVRPTLERTLRVLQLDYVDLYIIEVPMAFKPGDEIYPRDENGKWLYHKSNLCATWEAMEACKDAGLVKSLGVSNFNRRQLELILNKPGLKHKPVSNQVECHPYFTQPKLLKFCQQHDIVITAYSPLGTSRNPIWVNVSSPPLLKDALLNSLGKRYNKTAAQIVLRFNIQRGVVVIPKSFNLERIKENFQIFDFSLTEEEMKDIEALNKNVRFVELLMWRDHPEYPFHDEY
Purity > 95% by HPLC
Concentration 1mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.5) containing 1mM DTT, 0.1M NaCl, 10% glycerol
Other Names 3o5bred, CBAS2, SRD5B1
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap