AK2, 1-239aa, Human,His-Tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
Adenylate kinase (AK; adenosine triphosphate-adenosine monophosphate [ATP-AMP] phosphotransferase, EC 2.7.4.3) is a ubiquitous monomeric enzyme involved energy metabolism of prokaryotic and eukaryotic cells.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01101
Size 100 µg
Molecular Weight 28.6 kDa (259 aa)
Sequences MGSSHHHHHHSSGLVPRGSHMAPSVPAAEPEYPKGIRAVLLGPPGAGKGTQAPRLAENFCVCHLATGDMLRAMVASGSELGKKLKATMDAGKLVSDEMVVELIEKNLETPLCKNGFLLDGFPRTVRQAEMLDDLMEKRKEKLDSVIEFSIPDSLLIRRITGRLIHPKSGRSYHEEFNPPKEPMKDDITGEPLIRRSDDNEKALKIRLQAYHTQTTPLIEYYRKRGIHSAIDASQTPDVVFASILAAFSKATCKDLVMFI
Purity > 95% by HPLC
Concentration 1 mg/ml
Formulation Liquid. In PBS (pH 7.4) containing 2 mM DTT, 20% glycerol.
Other Names Adenylate Kinase2, ADK2.
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2018 TZYBIOTECH. All Rights Reserved. SiteMap