Home / Products / proteins / AIF1, 1-147aa, Human, His tag, E.coli

AIF1, 1-147aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
AIF1 (Allograft inflammatory factor 1) is induced by cytokines and interferon. This protein is thought to be involved in negative regulation of growth of vascular smooth muscle cells, which contributes to the antiinflammatory response to vessel wall trauma.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01093
Size 100 µg
Host E.coli
Accession
Molecular Weight 18.9kDa (167aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMSQTRDLQGGKAFGLLKAQQEERLDEINKQFLDDPKYSSDEDLPSKLEGFKEKYMEFDLNGNGDIDIMSLKRMLEKLGVPKTHLELKKLIGEVSSGSGETFSYPDFLRMMLGKRSAILKMILMYEEKAREKEKPTGPPAKKAISELP
Purity > 95% by HPLC
Concentration 0.5 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl buffer (pH 8.0) containing 2mM DTT, 20% glycerol, 200mM NaCl
Other Names Allograft inflammatory factor 1, AIF-1, IBA1, IRT-1, IRT1.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap