AGRP, 21-132aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
AGRP, also known as agouti-related protein also called agouti-related peptide, is a neuropeptide produced in the brain by the AGRP/NPY neuron. It is only synthesised in NPY-containing cell bodies located in the ventromedial part of the arcuate nucleus in the hypothalamus. AGRP is co-expressed with Neuropeptide Y and works by increasing appetite and decreasing metabolism and energy expenditure. It is one of the most potent and long-lasting of appetite stimulators. Recombinant human AGRP, fused to His-tag at N-terminus, was expressed in E.coli and purified by using conventional chromatography techniques.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01085
Size 20 µg
Molecular Weight 15.1kDa (137aa) confirmed by MALDI-TOF.
Sequences MGSSHHHHHHSSGLVPRGSHMGSHMAQMGLAPMEGIRRPDQALLPELPGLGLRAPLKKTTAEQAEEDLLQEAQALAEVLDLQDREPRSSRRCVRLHESCLGQQVPCCDPCATCYCRFFNAFCYCRKLGTAMNPCSRT
Purity > 95% by HPLC
Concentration 0.25mg/ml (determined by Bradford assay)
Formulation Liquid. In 20mM Tris-HCl (pH 8.5) containing 20% glycerol, 1mM DTT.
Other Names Agouti-related protein, AGRT, ART, ASIP2
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2018 TZYBIOTECH. All Rights Reserved. SiteMap