Home / Products / proteins / AGR3, 22-166aa, Human, His tag, E.coli

AGR3, 22-166aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
AGR3, also known as anterior gradient protein 3 homolog precursor, is a secreted cytoplasmic protein which is involved in metastasis induction and p53 tumour supressor inhibition. It may serve as molecular marker and potential therapeutic target for hormone-responsive breast tumours.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01084
Size 100 µg
Host E.coli
Accession
Molecular Weight 19.5 kDa (169aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMIAIKKEKRPPQTLSRGWGDDITWVQTYEEGLFYAQKSKKPLMVIHHLEDCQYSQALKKVFAQNEEIQEMAQNKFIMLNLMHETTDKNLSPDGQYVPRIMFVDPSLTVRADIAGRYSNRLYTYEPRDLPLLIENMKKALRLIQSEL
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol, 0.1M NaCl, 1mM DTT
Other Names Anterior gradient protein 3 homolog, AG3, BCMP11, hAG-3, HAG3, PDIA18
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.
CONTACT US
How to order

Featured Products

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap