ADIPOQ, 106-242aa, Human, His-tag, Baculovirus

Categories: [Proteins / Peptides]
ADIPOQ, as known as adiponectin, is an adipocyte-derived protein with wide ranging paracrine and dedocrine effects on metabolism and inflammation. It is induced during adipocyte differentiation, and its secretion is stimultated by insulin. This protein influences gonadotropin release, normal pregnancy, and assisted reproduction outcomes. Also, it is important factor in chronic liver diseases and chronic kidney diseases. Recombinant human ADIPOQ, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $302
  • Buy 5 for $286.9 each and save 5%
  • Buy 21 for $271.8 each and save 10%
  • Buy 31 for $256.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01071
Size 20 µg
Host Baculovirus
Accession
Molecular Weight 16.9kDa (146aa)13.5-18kDa (SDS-PAGE under reducing conditions.)
AP_Mol_Weight
Tag
Sequences ADPEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKFHCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLYADNDNDSTFTGFLLYHDHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Adiponectin, ADIPOQ, ACDC, ACRP30, ADIPQTL1, ADPN, APM-1, APM1, GBP28
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap