ACYP1, 1-99aa, Human, His tag, E.coli

Categories: [Proteins / Peptides]
ACYP1, also known as erythrocyte acylphosphatase, is a cytosolic enzyme that catalyzes the hydrolysis of the carboxyl-phosphate bond of acylphosphates. Two acylphophatase isoenzymes exist: ACYP1 and ACYP2.
List Price: $365
  • Buy 5 for $346.75 each and save 5%
  • Buy 21 for $328.5 each and save 10%
  • Buy 31 for $310.25 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01055
Size 100 µg
Host E.coli
Accession
Molecular Weight 13.6 kDa (122aa), confirmed by MALDI-TOF
AP_Mol_Weight
Tag N-6His
Sequences MGSSHHHHHHSSGLVPRGSHMGSMAEGNTLISVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPKSHIDKANFNNEKVILKLDYSDFQIVK
Purity > 95% by HPLC
Concentration 1.0 mg/ml (determined by BCA assay)
Formulation Liquid. 20mM Tris-HCl buffer (pH8.0) containing 20% glycerol 0.1M NaCl, 1mM DTT
Other Names Acylphosphatase-1; ACYPE.
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap