ACVR2A, 20-135aa, Human, His tag, Baculovirus

Categories: [Proteins / Peptides]
ACVR2A, also known as activin receptor type-2A, is involved in a wide range of biological processes including mesoderm induction, neural cell differentiation, bone remodeling, hematopoiesis, the regulation of reproductive physiology, inflammation, and carcinogenesis. They function through heteromeric complexes of type I and type II serine/threonine kinase receptors. Recombinant human ACVR2A, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
List Price: $302
  • Buy 5 for $286.9 each and save 5%
  • Buy 21 for $271.8 each and save 10%
  • Buy 31 for $256.7 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01051
Size 50 µg
Host Baculovirus
Accession
Molecular Weight 14.4kDa (124aa); 18-28KDa (SDS-PAGE under reducing conditions)
AP_Mol_Weight
Tag N-6His
Sequences AILGRSETQECLFFNANWEKDRTNQTGVEPCYGDKDKRRHCFATWKNISGSIEIVKQGCWLDDINCYDRTDCVEKKDSPEVYFCCCEGNMCNEKFSYFPEMEVTQPTSNPVTPKPPLEHHHHHH
Purity > 95% by HPLC
Concentration 0.5mg/ml (determined by Absorbance at 280nm)
Formulation Liquid. In Phosphate Buffered Saline (pH 7.4) containing 10% glycerol.
Other Names Activin receptor type-2A, ACVR2A, ACTRII, ACVR2
Bioactivity
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2024 TZYBIOTECH. All Rights Reserved. SiteMap