Acid phosphatase 1,1-158aa, Human, His-tagged, Recombinant, E.coli

Categories: [Proteins / Peptides]
Acid phosphatase 1, soluble, also known as ACP1, belongs to the phosphotyrosine protein. It functions as an acid phosphatase and a protein tyrosine phosphatase (PTPase) present in all human tissues, including adipocytes.
List Price: $487
  • Buy 5 for $462.65 each and save 5%
  • Buy 21 for $438.3 each and save 10%
  • Buy 31 for $413.95 each and save 15%
  • Buy 51 for

Properties

Data Sheet Click for Datasheet
Catalog Number TP01034
Size 100 µg
Molecular Weight 20.1 kDa (178 aa), confirmed by MALDI-TOF
Sequences MGSSHHHHHHSSGLVPRGSHMAEQATKSVLFVCLGNICRSPIAEAVFRKLVTDQNISENWVIDSGAVSDWNVGRSPDPRAVSCLRNHGIHTAHKARQITKEDFATFDYILCMDESNLRDLNRKSNQVKTCKAKIELLGSYDPQKQLIIEDPYYGNDSDFETVYQQCVRCCRAFLEKAH
Purity > 95% by HPLC
Concentration 1 mg/ml (determined by Bradford assay)
Formulation Liquid. In 20 mM MES 6.0, 0.1 mM PMSF, 2 mM EDTA, 10% glycerol
Other Names Acid phosphatase 1, soluble isoform b; ACP1; HAAP; LMW-PTP; Red cell acid phosphatase 1; Adipocyte acid phosphatase.
Storage Can be stored at +4°C short term (1-2 weeks). For long term storage, aliquot and store at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Postscript For research use only, not for use in diagnostic procedures.

© Copyright 2018 TZYBIOTECH. All Rights Reserved. SiteMap